Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vascular endothelial growth factor D (Vegfd)

Product Specifications

Product Name Alternative

C-Fos-induced growth factor

Abbreviation

Recombinant Rat Vegfd protein

Gene Name

Vegfd

UniProt

O35251

Expression Region

94-210aa

Organism

Rattus norvegicus (Rat)

Target Sequence

FAATFYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRR

Tag

N-terminal hFc1-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-3 (Flt4) receptor

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trihexyl Phosphate (>90%)
TRC-T794765-500MG 500 mg

Trihexyl Phosphate (>90%)

Sign In for Pricing
View Details
Calpain 13 (CAPN13) (NM_144575) Human Recombinant Protein
TP316674L 1 mg

Calpain 13 (CAPN13) (NM_144575) Human Recombinant Protein

Sign In for Pricing
View Details
Human LINC02874 activation kit by CRISPRa
GA117021 1 Kit

Human LINC02874 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC28A1 Human Gene Knockout Kit (CRISPR)
KN422897 1 Kit

SLC28A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-17F/IL-17F Protein (His Tag)
PKSM041076-01 10 µg

Recombinant Mouse Interleukin-17F/IL-17F Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-17F/IL-17F Protein (His Tag)
PKSM041076-02 50 µg

Recombinant Mouse Interleukin-17F/IL-17F Protein (His Tag)

Sign In for Pricing
View Details