Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Artemisia vulgaris Art v 2 allergen (art v 2)

Product Specifications

Product Name Alternative

Art v 2

Abbreviation

Recombinant Artemisia vulgaris art v 2 protein

Gene Name

Art v 2

UniProt

A6GVD5

Expression Region

24-162aa

Organism

Artemisia vulgaris (Mugwort)

Target Sequence

HETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDEIGKVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Probably involved in the defense reaction of plants against pathogens

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonucleotide Reductase M1 (RRM1) Mouse ELISA Kit
G7936 96 Tests

Ribonucleotide Reductase M1 (RRM1) Mouse ELISA Kit

Sign In for Pricing
View Details
P2Y12 (P2RY12) (NM_176876) Human Tagged Lenti ORF Clone
RC213478L1 10 µg

P2Y12 (P2RY12) (NM_176876) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-BIK (pT33) Phospho Antibody
MBS8233696-01 0.03 mL

Anti-BIK (pT33) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pT33) Phospho Antibody
MBS8233696-02 0.05 mL

Anti-BIK (pT33) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pT33) Phospho Antibody
MBS8233696-03 0.1 mL

Anti-BIK (pT33) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pT33) Phospho Antibody
MBS8233696-04 0.2 mL

Anti-BIK (pT33) Phospho Antibody

Sign In for Pricing
View Details