Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Envelope small membrane protein (E)

Product Specifications

Product Name Alternative

E protein; sM protein; E

Abbreviation

Recombinant Human coronavirus 229E Envelope small membrane protein

Gene Name

E

UniProt

P19741

Expression Region

1-77aa

Organism

Human coronavirus 229E (HCoV-229E)

Target Sequence

MFLKLVDDHALVVNVLLWCVVLIVILLVCITIIKLIKLCFTCHMFCNRTVYGPIKNVYHIYQSYMHIDPFPKRVIDF

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ionomycin Free Acid (85%)
TRC-I731243-1MG 1 mg

Ionomycin Free Acid (85%)

Sign In for Pricing
View Details
Uncoated Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
E-UNEL-M0054-01 5x 96 Tests

Uncoated Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit
E-UNEL-M0054-02 15x 96 Tests

Uncoated Mouse CCL1 (Chemokine C-C-Motif Ligand 1) ELISA Kit

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), Biotin conjugate, 0.1mg/mL
BNCB2214-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Carbitol Acetate
TRC-E495975-25G 25 g

Ethyl Carbitol Acetate

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF405S conjugate, 0.1mg/mL
BNC041725-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details