Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4), partial

Product Specifications

Product Name Alternative

Serotonin receptor 4

Abbreviation

Recombinant Human HTR4 protein, partial

Gene Name

HTR4

UniProt

Q13639

Expression Region

79-133aa

Organism

Homo sapiens (Human)

Target Sequence

IELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKM

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. HTR4 is coupled to G (s) G alpha proteins and mediates activation of adenylate cyclase activity

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NMNAT-1 Antibody (OTI1G4) [DyLight 650]
NBP2-73017C 0.1 mL

Mouse Monoclonal NMNAT-1 Antibody (OTI1G4) [DyLight 650]

Sign In for Pricing
View Details
GYLTL1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0923006 1.0 µg DNA

GYLTL1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CRYAA Rabbit Polyclonal Antibody
E10G07827 100 µL

CRYAA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Abhd12 Mouse shRNA Plasmid (Locus ID 76192)
TL505126 1 Kit

Abhd12 Mouse shRNA Plasmid (Locus ID 76192)

Sign In for Pricing
View Details
UBE2Q2 Antibody, FITC conjugated
CSB-PA845153HC01HU-01 50 µg

UBE2Q2 Antibody, FITC conjugated

Sign In for Pricing
View Details
UBE2Q2 Antibody, FITC conjugated
CSB-PA845153HC01HU-02 100 µg

UBE2Q2 Antibody, FITC conjugated

Sign In for Pricing
View Details