Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

Product Specifications

Product Name Alternative

SEZ-6; hSEZ-6; SEZ6

Abbreviation

Recombinant Human SEZ6 protein, partial

Gene Name

SEZ6

UniProt

Q53EL9

Expression Region

705-767aa

Organism

Homo sapiens (Human)

Target Sequence

PRNDTCPELPEIPNGWKSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQR

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

May play a role in cell-cell recognition and in neuronal membrane signaling. Seems to be important for the achievement of the necessary balance between dendrite elongation and branching during the elaboration of a complex dendritic arbor. Involved in the development of appropriate excitatory synaptic connectivity

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF405S conjugate, 0.1mg/mL
BNC042729-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details