Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial

Product Specifications

Product Name Alternative

Gastric H (+) /K (+) ATPase subunit beta; Proton pump beta chain

Abbreviation

Recombinant Human ATP4B protein, partial

Gene Name

ATP4B

UniProt

P51164

Expression Region

58-291aa

Organism

Homo sapiens (Human)

Target Sequence

CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

The beta subunit of the gastric H (+) /K (+) ATPase pump which transports H (+) ions in exchange for K (+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H (+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2) . Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Mouse Monoclonal Antibody (SK3), CF®514 Conjugate - Biotium Choice
P001-514-500 1x 500 µL

CD4 Mouse Monoclonal Antibody (SK3), CF®514 Conjugate - Biotium Choice

Sign In for Pricing
View Details
2-[2-(2-Propynyloxy)ethoxy]ethanol
TRC-P838460-1G 1 g

2-[2-(2-Propynyloxy)ethoxy]ethanol

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF405S conjugate, 0.1mg/mL
BNC041118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-SPS | Sucrose phosphate synthase, global, DyLight® 650 conjugated (40 µg)
AS03 035-DL650 40 µg

Anti-SPS | Sucrose phosphate synthase, global, DyLight® 650 conjugated (40 µg)

Sign In for Pricing
View Details
Klrd1 Rat Monoclonal Antibody [Clone ID: 15F.18D1]
AM31859FC-N 100 µg

Klrd1 Rat Monoclonal Antibody [Clone ID: 15F.18D1]

Sign In for Pricing
View Details
CABP4 (NM_001300895) Human Tagged ORF Clone
RG236245 10 µg

CABP4 (NM_001300895) Human Tagged ORF Clone

Sign In for Pricing
View Details