Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial

Product Specifications

Product Name Alternative

Proto-oncogene c-Kit; Tyrosine-protein kinase Kit

Abbreviation

Recombinant Mouse Kit protein, partial

Gene Name

Kit

UniProt

P05532-2

Expression Region

25-523aa

Organism

Mus musculus (Mouse)

Target Sequence

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHTLFTP

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(2,3-dichloropropyl) Ether
TRC-B426220-10MG 10 mg

Bis(2,3-dichloropropyl) Ether

Sign In for Pricing
View Details
ARL6 (NM_177976) Human Recombinant Protein
TP313584 20 µg

ARL6 (NM_177976) Human Recombinant Protein

Sign In for Pricing
View Details
Human ADIPOR2 (Adiponectin Receptor 2) CLIA Kit
E-CL-H0227-01 24 Tests

Human ADIPOR2 (Adiponectin Receptor 2) CLIA Kit

Sign In for Pricing
View Details
Human ADIPOR2 (Adiponectin Receptor 2) CLIA Kit
E-CL-H0227-02 48 Tests

Human ADIPOR2 (Adiponectin Receptor 2) CLIA Kit

Sign In for Pricing
View Details
Human ADIPOR2 (Adiponectin Receptor 2) CLIA Kit
E-CL-H0227-03 96 Tests

Human ADIPOR2 (Adiponectin Receptor 2) CLIA Kit

Sign In for Pricing
View Details
PCNA Polyclonal Antibody
E-AB-10010-01 20 µL

PCNA Polyclonal Antibody

Sign In for Pricing
View Details