Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)

Product Specifications

Product Name Alternative

Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor) ; CRLF2; CRL2, ILXR, TSLPR

Abbreviation

Recombinant Human CRLF2 protein, partial (Active)

Gene Name

CRLF2

UniProt

Q9HC73

Expression Region

25-231aa

Organism

Homo sapiens (Human)

Target Sequence

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor for thymic stromal lymphopoietin (TSLP) . Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2) . Implicated in the development of the hematopoietic system.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human TSLP (CSB-MP025141HUh7) at 2 μg/mL can bind Human CRLF2 protein.The EC50 is 41.01-45.10 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.9 kDa

References & Citations

Identification of amino acids in transmembrane domains of mutated cytokine receptor-like factor 2 and interleukin-7 receptor alpha required for constitutive signal transduction. Yamamoto R., Segawa R., Kato H., Niino Y., Sato T., Hiratsuka M., Hirasawa N. Biochim Biophys Acta Biomembr 1866:184359-184359 (2024)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NA3 N-Glycan
297610-01 10 µg

NA3 N-Glycan

Sign In for Pricing
View Details
NA3 N-Glycan
297610-02 20 µg

NA3 N-Glycan

Sign In for Pricing
View Details
ERV3, CT (ERV3-1, ERV3, HERV-R_7q21.2 provirus ancestral Env polyprotein, ERV-3 envelope protein, ERV3-1 envelope protein, Envelope polyprotein, HERV-R envelope protein, Surface protein, Transmembrane protein) (APC)
MBS6296680-01 0.2 mL

ERV3, CT (ERV3-1, ERV3, HERV-R_7q21.2 provirus ancestral Env polyprotein, ERV-3 envelope protein, ERV3-1 envelope protein, Envelope polyprotein, HERV-R envelope protein, Surface protein, Transmembrane protein) (APC)

Sign In for Pricing
View Details
ERV3, CT (ERV3-1, ERV3, HERV-R_7q21.2 provirus ancestral Env polyprotein, ERV-3 envelope protein, ERV3-1 envelope protein, Envelope polyprotein, HERV-R envelope protein, Surface protein, Transmembrane protein) (APC)
MBS6296680-02 5x 0.2 mL

ERV3, CT (ERV3-1, ERV3, HERV-R_7q21.2 provirus ancestral Env polyprotein, ERV-3 envelope protein, ERV3-1 envelope protein, Envelope polyprotein, HERV-R envelope protein, Surface protein, Transmembrane protein) (APC)

Sign In for Pricing
View Details
SELE (SELE, ELAM1, E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, Leukocyte-endothelial cell adhesion molecule 2, CD62E) (Azide free) (HRP)
041529-HRP 200 µL

SELE (SELE, ELAM1, E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, Leukocyte-endothelial cell adhesion molecule 2, CD62E) (Azide free) (HRP)

Sign In for Pricing
View Details
APP Recombinant Protein (Human)
RP001618 100 µg

APP Recombinant Protein (Human)

Sign In for Pricing
View Details