Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 2 (IGF2), partial

Product Specifications

Product Name Alternative

Insulin-like growth factor II; Somatomedin-A; T3M-11-derived growth factor

Abbreviation

Recombinant Human IGF2 protein, partial

Gene Name

IGF2

UniProt

P01344

Expression Region

25-91aa

Organism

Homo sapiens (Human)

Target Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Tag

N-terminal hFc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Metabolism

Relevance

The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable) . Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBN Rabbit Polyclonal Antibody (Cy7)
orb1050057 100 µL

NBN Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Fmoc-Ala-OH · H₂O
4003167.0100 100 g

Fmoc-Ala-OH · H₂O

Sign In for Pricing
View Details
Lentiviral human SUSD6 shRNA (UAS) - Lentiviral human SUSD6 shRNA (UAS) (100)
GTR15323757 1 Vial

Lentiviral human SUSD6 shRNA (UAS) - Lentiviral human SUSD6 shRNA (UAS) (100)

Sign In for Pricing
View Details
Olr383 3'UTR Luciferase Stable Cell Line
TU215159 1.0 mL

Olr383 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZGLP1 (NM_001103167) Human Over-expression Lysate
LS100125288-20ug 20 µg

ZGLP1 (NM_001103167) Human Over-expression Lysate

Sign In for Pricing
View Details
DNAJC13 Protein Vector (Human) (pPB-C-His)
PV073665 500 ng

DNAJC13 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details