Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 2 (IGF2), partial

Product Specifications

Product Name Alternative

Insulin-like growth factor II; Somatomedin-A; T3M-11-derived growth factor

Abbreviation

Recombinant Human IGF2 protein, partial

Gene Name

IGF2

UniProt

P01344

Expression Region

25-91aa

Organism

Homo sapiens (Human)

Target Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Tag

N-terminal hFc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Metabolism

Relevance

The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable) . Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP1 (NM_022912) Human Over-expression Lysate
LS065055 100 µg

REEP1 (NM_022912) Human Over-expression Lysate

Sign In for Pricing
View Details
Round filter paper grade 1, diameter 85 mm, high quality, for medium-fine precipitates, medium speed, 11 μm
FP085DME01QALC01 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Round filter paper grade 1, diameter 85 mm, high quality, for medium-fine precipitates, medium speed, 11 μm

Sign In for Pricing
View Details
V-ATPase C2 Rabbit Polyclonal Antibody
orb556712 100 µL

V-ATPase C2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BTRX-335140 100mg
A18583-100 100 mg

BTRX-335140 100mg

Sign In for Pricing
View Details
RHCG Antibody (HRP)
orb416158-01 50 µg

RHCG Antibody (HRP)

Sign In for Pricing
View Details
RHCG Antibody (HRP)
orb416158-02 100 µg

RHCG Antibody (HRP)

Sign In for Pricing
View Details