Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial (Active)

Product Specifications

Product Name Alternative

T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; CD8a; CD8A; MAL

Abbreviation

Recombinant Human CD8A protein, partial (Active)

Gene Name

CD8A

UniProt

P01732

Expression Region

22-182aa

Organism

Homo sapiens (Human)

Target Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs) . In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs) . This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD8A at 5 μg/mL can bind Anti-CD8A recombinant antibody (CSB-RA004966MA3HU) . The EC50 is 11.49-20.78 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.0 kDa

References & Citations

Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Wilson R.K. Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12943377/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nori® Monkey MMP-12 ELISA Kit
GR169149 96 Well

Nori® Monkey MMP-12 ELISA Kit

Ask
View Details
M/M016/FR489-SA-210x297/1-B AC Signs
139190 Pack of 1 Pictogram(s)

M/M016/FR489-SA-210x297/1-B AC Signs

Ask
View Details
MAN2A2, ID (MAN2A2, MANA2X, Alpha-mannosidase 2x, Alpha-mannosidase IIx, Mannosidase alpha class 2A member 2, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (Azide free) (HRP)
MBS6318169-01 0.2 mL

MAN2A2, ID (MAN2A2, MANA2X, Alpha-mannosidase 2x, Alpha-mannosidase IIx, Mannosidase alpha class 2A member 2, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (Azide free) (HRP)

Ask
View Details
MAN2A2, ID (MAN2A2, MANA2X, Alpha-mannosidase 2x, Alpha-mannosidase IIx, Mannosidase alpha class 2A member 2, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (Azide free) (HRP)
MBS6318169-02 5x 0.2 mL

MAN2A2, ID (MAN2A2, MANA2X, Alpha-mannosidase 2x, Alpha-mannosidase IIx, Mannosidase alpha class 2A member 2, Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (Azide free) (HRP)

Ask
View Details
QSOX2 AAV Vector (Human) (CMV)
38279101 1 μg

QSOX2 AAV Vector (Human) (CMV)

Ask
View Details
Recombinant Mouse CD59a / Protectin / MAC-IP Protein (Fc tag)
MBS2546824-01 0.05 mg

Recombinant Mouse CD59a / Protectin / MAC-IP Protein (Fc tag)

Ask
View Details