Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active)

Product Specifications

Product Name Alternative

Macrophage colony-stimulating factor 1 receptor; CSF-1 receptor (CSF-1-R; CSF-1R; M-CSF-R) (EC:2.7.10.1) . EC:2.7.10.1 ; Proto-oncogene c-Fms; CD115; Csf1r; Csfmr, Fms

Abbreviation

Recombinant Mouse Csf1r protein, partial (Active)

Gene Name

Csf1r

UniProt

P09581

Expression Region

20-511aa

Organism

Mus musculus (Mouse)

Target Sequence

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Yrosine-protein kinase that acts as a cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1 (CSB-MP006043MO) at 2 μg/mL can bind Mouse Csf1r. The EC50 is 3.226-4.264 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

84.1 kDa

References & Citations

The transcriptional landscape of the mammalian genome. Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Hayashizaki Y. Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED17, ID (MED17, ARC77, CRSP6, DRIP77, DRIP80, TRAP80, Mediator of RNA polymerase II transcription subunit 17, Activator-recruited cofactor 77kD component, Cofactor required for Sp1 transcriptional activation subunit 6, Mediator complex subunit 17, Thyro
MBS6319958-01 0.2 mL

MED17, ID (MED17, ARC77, CRSP6, DRIP77, DRIP80, TRAP80, Mediator of RNA polymerase II transcription subunit 17, Activator-recruited cofactor 77kD component, Cofactor required for Sp1 transcriptional activation subunit 6, Mediator complex subunit 17, Thyro

Sign In for Pricing
View Details
MED17, ID (MED17, ARC77, CRSP6, DRIP77, DRIP80, TRAP80, Mediator of RNA polymerase II transcription subunit 17, Activator-recruited cofactor 77kD component, Cofactor required for Sp1 transcriptional activation subunit 6, Mediator complex subunit 17, Thyro
MBS6319958-02 5x 0.2 mL

MED17, ID (MED17, ARC77, CRSP6, DRIP77, DRIP80, TRAP80, Mediator of RNA polymerase II transcription subunit 17, Activator-recruited cofactor 77kD component, Cofactor required for Sp1 transcriptional activation subunit 6, Mediator complex subunit 17, Thyro

Sign In for Pricing
View Details
N-Nitroso Gentamicin-3
CS-EO-01245 1 Each

N-Nitroso Gentamicin-3

Sign In for Pricing
View Details
Lentiviral human OR5M11 sgRNA gene knockout kit - Lentiviral human OR5M11 sgRNA gene knockout kit (plasmid)
GTR15376604 1 Vial

Lentiviral human OR5M11 sgRNA gene knockout kit - Lentiviral human OR5M11 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Piperonal Nitroso Impurity 2
RM-P162902-01 10 mg

Piperonal Nitroso Impurity 2

Sign In for Pricing
View Details
Piperonal Nitroso Impurity 2
RM-P162902-02 25 mg

Piperonal Nitroso Impurity 2

Sign In for Pricing
View Details