Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta growth factor (PGF)

Product Specifications

Product Name Alternative

PlGF; PGFL, PLGF

Abbreviation

Recombinant Human PGF protein

Gene Name

PGF

UniProt

P49763-2

Expression Region

19-149aa

Organism

Homo sapiens (Human)

Target Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform PlGF-1

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYB61 Antibody
orb792365 2 mg

MYB61 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Rars shRNA (UAS) - Lentiviral mouse Rars shRNA (UAS) (100)
GTR15176766 1 Vial

Lentiviral mouse Rars shRNA (UAS) - Lentiviral mouse Rars shRNA (UAS) (100)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
MBS2136633-01 0.1 mL

FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
MBS2136633-02 0.2 mL

FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
MBS2136633-03 0.5 mL

FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)
MBS2136633-04 1 mL

FITC Linked Monoclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2)

Sign In for Pricing
View Details