Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Protein Rv1269c

Product Specifications

Abbreviation

Recombinant Mycobacterium tuberculosis protein Rv1269c protein

UniProt

P9WM45

Expression Region

36-124aa

Organism

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Target Sequence

ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wright's Stain
STRWS-0500 500 mL

Wright's Stain

Sign In for Pricing
View Details
pBluescriptR-ADORA1 Plasmid
PVT17039 2 µg

pBluescriptR-ADORA1 Plasmid

Sign In for Pricing
View Details
RanBP3 Recombinant Antibody, RBITC Conjugated
bsm-62438R-RBITC-01 20 µL

RanBP3 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
RanBP3 Recombinant Antibody, RBITC Conjugated
bsm-62438R-RBITC-02 100 µL

RanBP3 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PDLIM3 Rabbit Polyclonal Antibody (HRP)
orb2105591 100 µL

PDLIM3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
S-Hydroperoxy Des (boric Acid) Bortezomib
465634-01 1 mg

S-Hydroperoxy Des (boric Acid) Bortezomib

Sign In for Pricing
View Details