Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Protein Rv1269c

Product Specifications

Abbreviation

Recombinant Mycobacterium tuberculosis protein Rv1269c protein

UniProt

P9WM45

Expression Region

36-124aa

Organism

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Target Sequence

ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mst2 Rabbit Polyclonal Antibody (AP)
orb920756 100 µL

Mst2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Radixin (RDX) Porcine ELISA Kit
G6181 96 Tests

Radixin (RDX) Porcine ELISA Kit

Sign In for Pricing
View Details
Amine PEG tritylthiol, Mp 5000
26138-500 500 mg

Amine PEG tritylthiol, Mp 5000

Sign In for Pricing
View Details
VDAC1 Recombinant Protein
OPCD07877-200UG 200 µg

VDAC1 Recombinant Protein

Sign In for Pricing
View Details
Pitpnb (BC034676) Mouse Untagged Clone
MC217798 10 µg

Pitpnb (BC034676) Mouse Untagged Clone

Sign In for Pricing
View Details
2-Azetidinepropanoic acid, 2- (methoxycarbonyl) -1- (phenylmethyl) -, methyl ester
orb3031741-01 200 mg

2-Azetidinepropanoic acid, 2- (methoxycarbonyl) -1- (phenylmethyl) -, methyl ester

Sign In for Pricing
View Details