Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Regakine-1

Product Specifications

Abbreviation

Recombinant Bovine Regakine-1 protein

UniProt

P82943

Expression Region

22-92aa

Organism

Bos taurus (Bovine)

Target Sequence

NEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEAVIFQTRSGRSICANPGQAWVQKYIEYLDQMSK

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Chemotactic activity for neutrophils and lymphocytes. Binds to heparin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spiramycin Embonate
TRC-S682370-25G 25 g

Spiramycin Embonate

Sign In for Pricing
View Details
TMEM130 (NM_152913) Human Recombinant Protein
TP306371 20 µg

TMEM130 (NM_152913) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS710618 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Replacement Cartridge for Label Printers
L9010-6CK 1 Each

Replacement Cartridge for Label Printers

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IGIP activation kit by CRISPRa
GA118575 1 Kit

Human IGIP activation kit by CRISPRa

Sign In for Pricing
View Details