Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Regakine-1

Product Specifications

Abbreviation

Recombinant Bovine Regakine-1 protein

UniProt

P82943

Expression Region

22-92aa

Organism

Bos taurus (Bovine)

Target Sequence

NEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEAVIFQTRSGRSICANPGQAWVQKYIEYLDQMSK

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Chemotactic activity for neutrophils and lymphocytes. Binds to heparin

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RERE siRNA Oligos set (Human)
38820171 3x 5 nmol

RERE siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)
MBS1307342-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)
MBS1307342-02 0.02 mg (Yeast)

Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)
MBS1307342-03 0.1 mg (E-Coli)

Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)
MBS1307342-04 0.1 mg (Yeast)

Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)
MBS1307342-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhi Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details