Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial

Product Specifications

Product Name Alternative

Sodium channel protein brain I subunit alpha; Sodium channel protein type I subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.1

Abbreviation

Recombinant Human SCN1A protein, partial

Gene Name

SCN1A

UniProt

P35498

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Pore-forming subunit of Nav1.1, a voltage-gated sodium (Nav) channel that directly mediates the depolarizing phase of action potentials in excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by switching between closed and open conformations depending on the voltage difference across the membrane. In the open conformation they allow Na (+) ions to selectively pass through the pore, along their electrochemical gradient. The influx of Na (+) ions provokes membrane depolarization, initiating the propagation of electrical signals throughout cells and tissues. By regulating the excitability of neurons, ensures that they respond appropriately to synaptic inputs, maintaining the balance between excitation and inhibition in brain neural circuits. Nav1.1 plays a role in controlling the excitability and action potential propagation from somatosensory neurons, thereby contributing to the sensory perception of mechanically-induced pain

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLK2 Antibody
8C18624-AAT 50 µg

TLK2 Antibody

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF647 conjugate, 0.1mg/mL
BNC472747-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Pdpn activation kit by CRISPRa
GA201684 1 Kit

Mouse Pdpn activation kit by CRISPRa

Sign In for Pricing
View Details
CDK8 Human Gene Knockout Kit (CRISPR)
KN212592RB 1 Kit

CDK8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PAFAH1B3 activation kit by CRISPRa
GA103372 1 Kit

Human PAFAH1B3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Retroperitoneal region
CS804665 5x 5 µm

Tissue FFPE Sections, Retroperitoneal region

Sign In for Pricing
View Details