Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial

Product Specifications

Product Name Alternative

Sodium channel protein brain I subunit alpha; Sodium channel protein type I subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.1

Abbreviation

Recombinant Human SCN1A protein, partial

Gene Name

SCN1A

UniProt

P35498

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Pore-forming subunit of Nav1.1, a voltage-gated sodium (Nav) channel that directly mediates the depolarizing phase of action potentials in excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by switching between closed and open conformations depending on the voltage difference across the membrane. In the open conformation they allow Na (+) ions to selectively pass through the pore, along their electrochemical gradient. The influx of Na (+) ions provokes membrane depolarization, initiating the propagation of electrical signals throughout cells and tissues. By regulating the excitability of neurons, ensures that they respond appropriately to synaptic inputs, maintaining the balance between excitation and inhibition in brain neural circuits. Nav1.1 plays a role in controlling the excitability and action potential propagation from somatosensory neurons, thereby contributing to the sensory perception of mechanically-induced pain

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL
BNC400413-500 1x 500 µL

Chromogranin A (CHGA/413), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAF1 Mouse Monoclonal Antibody [Clone ID: PBB-1]
AM00132PU-N 100 µg

RAF1 Mouse Monoclonal Antibody [Clone ID: PBB-1]

Sign In for Pricing
View Details
PE Anti-Human IL-21 Antibody[3A3-N2]
E-AB-F1202D-01 20 Tests

PE Anti-Human IL-21 Antibody[3A3-N2]

Sign In for Pricing
View Details
PE Anti-Human IL-21 Antibody[3A3-N2]
E-AB-F1202D-02 100 Tests

PE Anti-Human IL-21 Antibody[3A3-N2]

Sign In for Pricing
View Details
PE Anti-Human IL-21 Antibody[3A3-N2]
E-AB-F1202D-03 2x 100 Tests

PE Anti-Human IL-21 Antibody[3A3-N2]

Sign In for Pricing
View Details
p62 Antibody SQSTM1 (phospho-S207)
F48756-0.08ML 0.08 mL

p62 Antibody SQSTM1 (phospho-S207)

Sign In for Pricing
View Details