Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD226 antigen (CD226), partial

Product Specifications

Product Name Alternative

DNAX accessory molecule 1

Abbreviation

Recombinant Human CD226 protein, partial

Gene Name

CD226

UniProt

Q15762

Expression Region

19-247aa

Organism

Homo sapiens (Human)

Target Sequence

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cell surface receptor that plays an important role in the immune system, particularly in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-cells and NK cells. Functions as a costimulatory receptor upon recognition of target cells, such as virus-infected or tumor cells. Upon binding to its ligands PVR/CD155 or NECTIN2/CD112 on target cells, promotes the cytotoxic activity of NK cells and CTLs, enhancing their ability to kill these cells. Mechanistically, phosphorylation by Src kinases such as LYN of FYN, enables binding to adapter GRB2, leading to activation of VAV1, PI3K and PLCG1. Promotes also activation of kinases ERK and AKT, as well as calcium fluxes

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BclI
K3009-2500 2500 U

BclI

Sign In for Pricing
View Details
CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 650)
244502-ML650 100 µL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 650)

Sign In for Pricing
View Details
Plac9 3'UTR Luciferase Stable Cell Line
TU116486 1.0 mL

Plac9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Protein Msh2, hMSH2, MutS Protein Homolog 2) (APC)
MBS6401275-01 0.1 mL

MSH2 (DNA Mismatch Repair Protein Msh2, hMSH2, MutS Protein Homolog 2) (APC)

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Protein Msh2, hMSH2, MutS Protein Homolog 2) (APC)
MBS6401275-02 5x 0.1 mL

MSH2 (DNA Mismatch Repair Protein Msh2, hMSH2, MutS Protein Homolog 2) (APC)

Sign In for Pricing
View Details
Rat Anti-Mouse IgM mAb (APC)
orb2710456 100 Tests

Rat Anti-Mouse IgM mAb (APC)

Sign In for Pricing
View Details