Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nectin-2 (NECTIN2), partial

Product Specifications

Product Name Alternative

Herpes virus entry mediator B; Nectin cell adhesion molecule 2; Poliovirus receptor-related protein 2

Abbreviation

Recombinant Human NECTIN2 protein, partial

Gene Name

NECTIN2

UniProt

Q92692-2

Expression Region

32-360aa

Organism

Homo sapiens (Human)

Target Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ferritin heavy chain ELISA Kit
MBS761567-01 48 Well

Human Ferritin heavy chain ELISA Kit

Sign In for Pricing
View Details
Human Ferritin heavy chain ELISA Kit
MBS761567-02 96 Well

Human Ferritin heavy chain ELISA Kit

Sign In for Pricing
View Details
Human Ferritin heavy chain ELISA Kit
MBS761567-03 5x 96 Well

Human Ferritin heavy chain ELISA Kit

Sign In for Pricing
View Details
Human Ferritin heavy chain ELISA Kit
MBS761567-04 10x 96 Well

Human Ferritin heavy chain ELISA Kit

Sign In for Pricing
View Details
PLIN3, ID (PLIN3, M6PRBP1, TIP47, Perilipin-3, 47kD mannose 6-phosphate receptor-binding protein, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1, Placental protein 17) (MaxLight 750)
MBS6334969-01 0.1 mL

PLIN3, ID (PLIN3, M6PRBP1, TIP47, Perilipin-3, 47kD mannose 6-phosphate receptor-binding protein, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1, Placental protein 17) (MaxLight 750)

Sign In for Pricing
View Details
PLIN3, ID (PLIN3, M6PRBP1, TIP47, Perilipin-3, 47kD mannose 6-phosphate receptor-binding protein, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1, Placental protein 17) (MaxLight 750)
MBS6334969-02 5x 0.1 mL

PLIN3, ID (PLIN3, M6PRBP1, TIP47, Perilipin-3, 47kD mannose 6-phosphate receptor-binding protein, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1, Placental protein 17) (MaxLight 750)

Sign In for Pricing
View Details