Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Monocyte differentiation antigen CD14 (CD14), partial (Active)

Product Specifications

Product Name Alternative

Monocyte differentiation antigen CD14; My23 antigen; Myeloid cell-specific leucine-rich glycoprotein; CD14

Abbreviation

Recombinant Human CD14 protein, partial (Active)

Gene Name

CD14

UniProt

P08571

Expression Region

20-344aa

Organism

Homo sapiens (Human)

Target Sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Coreceptor for bacterial lipopolysaccharide . In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) . Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD14 at 2 μg/mL on an Nickel Coated plate can bind Anti-CD14 recombinant antibody (CSB-RA004879MA1HU) . The EC50 is 2.148-2.447 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.8 kDa

References & Citations

Natural selection in the TLR-related genes in the course of primate evolution. Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A. Immunogenetics 60:727-735 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Rabbit Phosphoglucomutase, conjugated with Biotin Antibody
orb98146 10 mg

Sheep Rabbit Phosphoglucomutase, conjugated with Biotin Antibody

Sign In for Pricing
View Details
PrePack Ni-IDA Purose® 6 FF
E231-40902-02 5x 5 mL

PrePack Ni-IDA Purose® 6 FF

Sign In for Pricing
View Details
NMRAL1 Knockout 786-O Polyclonal Cells
ARG5047 1 Million

NMRAL1 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Survivin (phospho Thr34) Polyclonal Antibody
UB-GEN-164 100 µL

Survivin (phospho Thr34) Polyclonal Antibody

Sign In for Pricing
View Details
Elmod2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6608703 1.0 µg DNA

Elmod2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Drebrin A/E (Developmentally-regulated brain protein, Dbn1) (Biotin)
D9452-01B-Biotin 100 µL

Drebrin A/E (Developmentally-regulated brain protein, Dbn1) (Biotin)

Sign In for Pricing
View Details