Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial, Biotinylated (Active)

Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor) ; CRLF2; CRL2, ILXR, TSLPR

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Receptor for thymic stromal lymphopoietin (TSLP) . Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2) . Implicated in the development of the hematopoietic system.

Measured by its binding ability in a functional ELISA.Immobilized Human CRLF2 at 2 μg/mL on streptavidin coated plates can bind Anti-CRLF2 recombinant antibody (CSB-RA005983MA1HU) . The EC50 is 3.631-7.668 ng/mL.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Identification of amino acids in transmembrane domains of mutated cytokine receptor-like factor 2 and interleukin-7 receptor alpha required for constitutive signal transduction. Yamamoto R., Segawa R., Kato H., Niino Y., Sato T., Hiratsuka M., Hirasawa N. Biochim Biophys Acta Biomembr 1866:184359-184359 (2024)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.