Recombinant Human Neurogenin-2 (NEUROG2)
Product Specifications
Product Name Alternative
Class A basic helix-loop-helix protein 8; Protein atonal homolog 4
Abbreviation
Recombinant Human NEUROG2 protein
Gene Name
NEUROG2
UniProt
Q9H2A3
Expression Region
1-272aa
Organism
Homo sapiens (Human)
Target Sequence
MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Tag
C-terminal 10xHis-HSA-tagged
Type
Developed Protein
Source
Mammalian cell
Field of Research
Epigenetics and Nuclear Signaling
Relevance
Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3')
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
96.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881649-100 1x 100 µL
CD15 / FUT4 (Reed-Sternberg Cell Marker), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![ZNF79 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D2]](https://cdn.genprice.uk/products/937/6868c3f3994c49e6dc4026d8/imageurl/ta809109bm.webp)
TA809109BM 100 µL
ZNF79 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D2]
Sign In for Pricing
View Details 
BNC740692-100 1x 100 µL
CD56 / NCAM (123A8, same as 56C04), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![ZNF264 Mouse Monoclonal Antibody [Clone ID: OTI10F5]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908880/imageurl/cf810494.webp)
CF810494 100 µg
ZNF264 Mouse Monoclonal Antibody [Clone ID: OTI10F5]
Sign In for Pricing
View Details ![FAHD2A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H7]](https://cdn.genprice.uk/products/937/68dd1b65061270361ea14340/imageurl/ta500976bm.webp)
TA500976BM 100 µL
FAHD2A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H7]
Sign In for Pricing
View Details 