Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurogenin-2 (NEUROG2)

Product Specifications

Product Name Alternative

Class A basic helix-loop-helix protein 8; Protein atonal homolog 4

Abbreviation

Recombinant Human NEUROG2 protein

Gene Name

NEUROG2

UniProt

Q9H2A3

Expression Region

1-272aa

Organism

Homo sapiens (Human)

Target Sequence

MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3')

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

96.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A8 Antibody
8C19621-AAT 50 µg

SLC30A8 Antibody

Sign In for Pricing
View Details
ZNRD2 Rabbit Polyclonal Antibody
TA366153 100 µL

ZNRD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WWOX Antibody
KC-4002-01 50 μL

WWOX Antibody

Sign In for Pricing
View Details
WWOX Antibody
KC-4002-02 100 µL

WWOX Antibody

Sign In for Pricing
View Details
WWOX Antibody
KC-4002-03 1 mL

WWOX Antibody

Sign In for Pricing
View Details
Strept. Avidin Colloidal Gold, 1mL 5nm
GA-02-5 1 mL

Strept. Avidin Colloidal Gold, 1mL 5nm

Sign In for Pricing
View Details