Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja atra Acidic phospholipase A2 2

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

Abbreviation

Recombinant Naja atra Acidic phospholipase A2 2 protein

UniProt

Q91133

Expression Region

28-146aa

Organism

Naja atra (Chinese cobra)

Target Sequence

NLYQFKNMIQCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDHCYNEAEKISGCWPYSKTYSYECSQGTLTCKGGNNACAAAVCDCDRLAAICFAGAPYNNNNYNIDLKARCQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vps37d Rabbit Polyclonal Antibody
TA363460 100 µL

Vps37d Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Thyroid gland
CP565442 150 µg

Tissue Protein Lysate, Thyroid gland

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS510768 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
BstX2I, 100U
RE1242 100 U

BstX2I, 100U

Sign In for Pricing
View Details
FITC Anti-Human CD90 Antibody[5E10]
E-AB-F1167C-01 20 Tests

FITC Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
FITC Anti-Human CD90 Antibody[5E10]
E-AB-F1167C-02 100 Tests

FITC Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details