Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atrax robustus Delta-hexatoxin-Ar1a

Product Specifications

Product Name Alternative

Delta-atracotoxin-Ar1; Delta-atracotoxin-Ar1a; Robustoxin

Abbreviation

Recombinant Atrax robustus Delta-hexatoxin-Ar1a protein

UniProt

P01478

Expression Region

1-42aa

Organism

Atrax robustus (Sydney funnel-web spider)

Target Sequence

CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQTTITGLFKKC

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Inhibits tetrodotoxin-sensitive voltage-gated sodium channels (Nav) by binding to site 3. It slows the inactivation, causes a prolongation of action potential duration resulting in repetitive firing in autonomic and motor nerve fibers. Does not depolarize the resting potential. Does not affect tetrodotoxin-resistant sodium channels. This lethal neurotoxin is active on both insect and mammalian voltage-gated sodium channels

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylene Terephthalate Cyclic Dimer-d8
HY-W749231 1 Each

Ethylene Terephthalate Cyclic Dimer-d8

Sign In for Pricing
View Details
CCL24 Antibody, HRP conjugated
CSB-PA05909B0Rb-01 50 µg

CCL24 Antibody, HRP conjugated

Sign In for Pricing
View Details
CCL24 Antibody, HRP conjugated
CSB-PA05909B0Rb-02 100 µg

CCL24 Antibody, HRP conjugated

Sign In for Pricing
View Details
PASK/STK37 Rabbit Polyclonal Antibody (Cy7)
orb1077159 100 µL

PASK/STK37 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Mmu-miR-124-5p miRNA Mimic
orb1875792-01 5 nmol

Mmu-miR-124-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-124-5p miRNA Mimic
orb1875792-02 10 nmol

Mmu-miR-124-5p miRNA Mimic

Sign In for Pricing
View Details