Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Versican core protein (Vcan), partial

Product Specifications

Product Name Alternative

Chondroitin sulfate proteoglycan core protein 2; Large fibroblast proteoglycan; PG-M

Abbreviation

Recombinant Mouse Vcan protein, partial

Gene Name

Vcan

UniProt

Q62059

Expression Region

24-146aa

Organism

Mus musculus (Mouse)

Target Sequence

AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LI Cadherin/CDH17 Antibody Fluoro550 Conjugated
A06389-1-Fluoro550 100 µg/Vial

Anti-LI Cadherin/CDH17 Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Ibrutinib Impurity 14
RM-I182014-01 10 mg

Ibrutinib Impurity 14

Sign In for Pricing
View Details
Ibrutinib Impurity 14
RM-I182014-02 25 mg

Ibrutinib Impurity 14

Sign In for Pricing
View Details
Ibrutinib Impurity 14
RM-I182014-03 50 mg

Ibrutinib Impurity 14

Sign In for Pricing
View Details
Ibrutinib Impurity 14
RM-I182014-04 100 mg

Ibrutinib Impurity 14

Sign In for Pricing
View Details
POU5F1/OCT4 Mouse mAb Antibody
orb397235 100 µL

POU5F1/OCT4 Mouse mAb Antibody

Sign In for Pricing
View Details