Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thymidylate synthase (Tyms)

Product Specifications

Product Name Alternative

Tyms

Abbreviation

Recombinant Mouse Tyms protein

Gene Name

Tyms

UniProt

P07607

Expression Region

1-307aa

Organism

Mus musculus (Mouse)

Target Sequence

MLVVGSELQSDAQQLSAEAPRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDMDSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKMEMAV

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Catalyzes the reductive methylation of 2'-deoxyuridine 5'-monophosphate (dUMP) to thymidine 5'-monophosphate (dTMP), using the cosubstrate, 5,10- methylenetetrahydrofolate (CH2H4folate) as a 1-carbon donor and reductant and contributes to the de novo mitochondrial thymidylate biosynthesis pathway

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Phosphorylated CTD-interacting factor 1, Pcif1 ELISA KIT
ELI-35640m 96 Tests

Mouse Phosphorylated CTD-interacting factor 1, Pcif1 ELISA KIT

Sign In for Pricing
View Details
CAST discontinued
309323 100 µL

CAST discontinued

Sign In for Pricing
View Details
Recombinant human alpha-Synuclein (1-60aa) protein
SNA3009-500 500 µg

Recombinant human alpha-Synuclein (1-60aa) protein

Sign In for Pricing
View Details
Zbtb37 siRNA Oligos set (Rat)
50704176 3x 5 nmol

Zbtb37 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 570 (ZNF570)
MBS1307104-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 570 (ZNF570)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 570 (ZNF570)
MBS1307104-02 0.02 mg (Yeast)

Recombinant Human Zinc finger protein 570 (ZNF570)

Sign In for Pricing
View Details