Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Alpha N-terminal protein methyltransferase 1 (tae1)

Product Specifications

Product Name Alternative

Translation associated element 1; X-Pro-Lys N-terminal protein methyltransferase 1

Abbreviation

Recombinant SchizosaccharoMyces pombe tae1 protein

Gene Name

Tae1

UniProt

O13748

Expression Region

1-219aa

Organism

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Target Sequence

MDPEKFYSDAIDYWNGVQPTVDGMLGGLGTGRIPQTDVVGSRTFLNRLNYRIGKIENLVAADCGAGIGRVTENVLLKIASHVDLVEPVENFISTAKKQLATKPCSFINVGLQNWTPEKNRYGLIWNQWCLSHLTDEDLIAYLSRCCEAIQEKGVICVKENVSSFEDTFDPIDSSVTRCEQSLKSLFKKANLVVVAETLQHGFPEELFPVKMYALVPHSS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klk1b22 Mouse shRNA Plasmid (Locus ID 13646)
TR509221 1 Kit

Klk1b22 Mouse shRNA Plasmid (Locus ID 13646)

Sign In for Pricing
View Details
Mouse Monoclonal A2BP1 Antibody (D8H8) [HRP]
NBP2-13169H 0.1 mL

Mouse Monoclonal A2BP1 Antibody (D8H8) [HRP]

Sign In for Pricing
View Details
L2hgdh (NM_145443) Mouse Recombinant Protein
TP507410 20 µg

L2hgdh (NM_145443) Mouse Recombinant Protein

Sign In for Pricing
View Details
CXCL11 siRNA (Mouse)
CRM5634-01 15 nmol

CXCL11 siRNA (Mouse)

Sign In for Pricing
View Details
CXCL11 siRNA (Mouse)
CRM5634-02 30 nmol

CXCL11 siRNA (Mouse)

Sign In for Pricing
View Details
CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 750)
MBS6467029-01 0.1 mL

CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 750)

Sign In for Pricing
View Details