Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sterol carrier protein 2 (SCP2)

Product Specifications

Product Name Alternative

Acetyl-CoA C-myristoyltransferase; Non-specific lipid-transfer protein; Propanoyl-CoA C-acyltransferase; SCP-2/3-oxoacyl-CoA thiolase; SCP-2/thiolase; SCP-chi; SCPX; Sterol carrier protein X

Abbreviation

Recombinant Human SCP2 protein

Gene Name

SCP2

UniProt

P22307

Expression Region

1-547aa

Organism

Homo sapiens (Human)

Target Sequence

MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transport

Relevance

Plays a crucial role in the peroxisomal oxidation of branched-chain fatty acids. Catalyzes the last step of the peroxisomal beta-oxidation of branched chain fatty acids and the side chain of the bile acid intermediates di- and trihydroxycoprostanic acids (DHCA and THCA) . Also active with medium and long straight chain 3-oxoacyl-CoAs. Stimulates the microsomal conversion of 7-dehydrocholesterol to cholesterol and transfers phosphatidylcholine and 7-dehydrocholesterol between membrances, in vitro. Isoforms SCP2 and SCPx cooperate in peroxisomal oxidation of certain naturally occurring tetramethyl-branched fatty acyl-CoAs

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

65.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TMEM97 shRNA (UAS) - Lentiviral human TMEM97 shRNA (UAS, RFP) plasmid
GTR15288517 1 Vial

Lentiviral human TMEM97 shRNA (UAS) - Lentiviral human TMEM97 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Monoclonal DLL4 Antibody (447506) [FITC]
FAB1506F 0.1 mL

Rat Monoclonal DLL4 Antibody (447506) [FITC]

Sign In for Pricing
View Details
Lentiviral human DIP2B shRNA (UAS) - Lentiviral human DIP2B shRNA (UAS, iRFP) (25)
GTR15139994 1 Vial

Lentiviral human DIP2B shRNA (UAS) - Lentiviral human DIP2B shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Neural Cell Adhesion Molecule 1 (NCAM1) Antibody
abx331450 100 µL

Neural Cell Adhesion Molecule 1 (NCAM1) Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis LPS (APC) discontinued
C4250-12F-APC 100 µL

Chlamydia trachomatis LPS (APC) discontinued

Sign In for Pricing
View Details
Rabbit Procollagen 1 N-terminal peptide, P1NP ELISA KIT
E0279Rb-01 48 Well

Rabbit Procollagen 1 N-terminal peptide, P1NP ELISA KIT

Sign In for Pricing
View Details