Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev)

Product Specifications

Product Name Alternative

ART/TRS; Anti-repression transactivator; Regulator of expression of viral proteins

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype B rev protein

Gene Name

Rev

UniProt

P04618

Expression Region

1-116aa

Organism

Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)

Target Sequence

MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Escorts unspliced or incompletely spliced viral pre-mRNAs (late transcripts) out of the nucleus of infected cells. These pre-mRNAs carry a recognition sequence called Rev responsive element (RRE) located in the env gene, that is not present in fully spliced viral mRNAs (early transcripts) . This function is essential since most viral proteins are translated from unspliced or partially spliced pre-mRNAs which cannot exit the nucleus by the pathway used by fully processed cellular mRNAs. Rev itself is translated from a fully spliced mRNA that readily exits the nucleus. Rev's nuclear localization signal (NLS) binds directly to KPNB1/Importin beta-1 without previous binding to KPNA1/Importin alpha-1. KPNB1 binds to the GDP bound form of RAN (Ran-GDP) and targets Rev to the nucleus. In the nucleus, the conversion from Ran-GDP to Ran-GTP dissociates Rev from KPNB1 and allows Rev's binding to the RRE in viral pre-mRNAs. Rev multimerization on the RRE via cooperative assembly exposes its nuclear export signal (NES) to the surface. Rev can then form a complex with XPO1/CRM1 and Ran-GTP, leading to nuclear export of the complex. Conversion from Ran-GTP to Ran-GDP mediates dissociation of the Rev/RRE/XPO1/RAN complex, so that Rev can return to the nucleus for a subsequent round of export. Beside KPNB1, also seems to interact with TNPO1/Transportin-1, RANBP5/IPO5 and IPO7/RANBP7 for nuclear import. The nucleoporin-like HRB/RIP is an essential cofactor that probably indirectly interacts with Rev to release HIV RNAs from the perinuclear region to the cytoplasm

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETDB1
CSB-CL619960HU1 10 μg Plasmid + 200 μL Glycerol

SETDB1

Sign In for Pricing
View Details
B4galt7 3'UTR Lenti-reporter-Luc Vector
12959084 1.0 µg

B4galt7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) (MaxLight 750) discontinued
227008-ML750 100 µL

Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PTPLA (HACD1) Human Gene Knockout Kit (CRISPR)
KN403054 1 Kit

PTPLA (HACD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LentimiRa-rno-miR-539-3p Vector
mr40893 500 ng

LentimiRa-rno-miR-539-3p Vector

Sign In for Pricing
View Details
RPS2P17 ORF Vector (Human) (pORF)
ORF031571 1.0 µg DNA

RPS2P17 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details