Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet factor 4 (PF4)

Product Specifications

Product Name Alternative

C-X-C motif chemokine 4; Iroplact; Oncostatin-A

Abbreviation

Recombinant Human PF4 protein

Gene Name

PF4

UniProt

P02776

Expression Region

32-101aa

Organism

Homo sapiens (Human)

Target Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation. Acts via different functional receptors including CCR1, CXCR3A or CXCR3B. Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling. Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence. Chemotactic for neutrophils and monocytes via CCR1. Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis. In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition. Interacts with thrombomodulin/THBD to enhance the activation of protein C and thus potentiates its anticoagulant activity

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-EIF2AK4 antibody
STJ114492 100 µl

Anti-EIF2AK4 antibody

Ask
View Details
Frizzled homolog 1 (FZD1) (NM_003505) Human Tagged ORF Clone Lentiviral Particle
RC208603L3V 200 µL

Frizzled homolog 1 (FZD1) (NM_003505) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
CT117, NT (SOGA1, C20orf117, KIAA0889, SOGA, Protein SOGA1, SOGA family member 1, Suppressor of glucose by autophagy, Suppressor of glucose, autophagy-associated protein 1, N-terminal form, C-terminal 80kD form) (Biotin) discontinued
034311-Biotin 200 µL

CT117, NT (SOGA1, C20orf117, KIAA0889, SOGA, Protein SOGA1, SOGA family member 1, Suppressor of glucose by autophagy, Suppressor of glucose, autophagy-associated protein 1, N-terminal form, C-terminal 80kD form) (Biotin) discontinued

Ask
View Details
KIF16B Knockout A549 Polyclonal Cells
ARG34476 1 Million

KIF16B Knockout A549 Polyclonal Cells

Ask
View Details
Vinyl chloride
S-3805 1 mL

Vinyl chloride

Ask
View Details
FGFR1 antibody (Tyr154)
70R-37431 100 ug

FGFR1 antibody (Tyr154)

Ask
View Details