Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage phi6 Major outer capsid protein (P8)

Product Specifications

Product Name Alternative

Protein P8

Abbreviation

Recombinant Pseudomonas phage phi6 Major outer capsid protein

Gene Name

P8

UniProt

P07579

Expression Region

1-149aa

Organism

Pseudomonas phage phi6 (Bacteriophage phi-6)

Target Sequence

MLLPVVARAAVPAIESAIAATPGLVSRIAAAIGSKVSPSAILAAVKSNPVVAGLTLAQIGSTGYDAYQQLLENHPEVAEMLKDLSFKADEIQPDFIGNLGQYREELELVEDAARFVGGMSNLIRLRQALELDIKYYGLKMQLNDMGYRS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Assembles to form an icosahedral capsid with a T=13 symmetry. Drives the penetration of the inner capsid (core) into the cytoplasm

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Heat Shock Protein 20 HSP 20 ELISA kit
GTR10453865 96 Well

Goat Heat Shock Protein 20 HSP 20 ELISA kit

Sign In for Pricing
View Details
ACBD6 Blocking Peptide
33R-2288 100 ug

ACBD6 Blocking Peptide

Sign In for Pricing
View Details
TNNT3 (C-term) Goat Polyclonal Antibody
AP32711PU-N 100 µg

TNNT3 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
IL17RB Protein Vector (Human) (pPB-N-His)
PV087451 500 ng

IL17RB Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Colec12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7205006 1.0 µg DNA

Colec12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Kcnk5 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4350204 1.0 µg DNA

Kcnk5 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details