Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyberlindnera jadinii Uricase

Product Specifications

Product Name Alternative

Urate oxidase

Abbreviation

Recombinant Cyberlindnera jadinii Uricase protein

UniProt

P78609

Expression Region

1-303aa

Organism

Cyberlindnera jadinii (Torula yeast)

Target Sequence

MSTTLSSSTYGKDNVKFLKVKKDPQNPKKQEVMEATVTCLLEGGFDTSYTEADNSSIVPTDTVKNTILVLAKTTEIWPIERFAAKLATHFVEKYSHVSGVSVKIVQDRWVKYAVDGKPHDHSFIHEGGEKRITDLYYKRSGDYKLSSAIKDLTVLKSTGSMFYGYNKCDFTTLQPTTDRILSTDVDATWVWDNKKIGSVYDIAKAADKGIFDNVYNQAREITLTTFALENSPSVQATMFNMATQILEKACSVYSVSYALPNKHYFLIDLKWKGLENDNELFYPSPHPNGLIKCTVVRKEKTKL

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S) -allantoin

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL
BNC471922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF647 conjugate, 0.1mg/mL
BNC471878-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF488A conjugate, 0.1mg/mL
BNC881660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details