Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia virus Qbeta Capsid protein

Product Specifications

Product Name Alternative

Coat protein

Abbreviation

Recombinant Escherichia virus Qbeta Capsid protein

UniProt

P03615

Expression Region

1-133aa

Organism

Escherichia virus Qbeta (Bacteriophage Q-beta)

Target Sequence

MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins) . Involved in viral genome encapsidation through the interaction between a capsid protein dimer and the multiple packaging signals present in the RNA genome. Binding of the capsid proteins to the viral RNA induces a conformational change required for efficient T=3 shell formation. The capsid also contains 1 copy of the A2 maturation protein

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dichloro-3-nitroquinoline
TRC-D439308-10MG 10 mg

2,4-Dichloro-3-nitroquinoline

Sign In for Pricing
View Details
2-(2-Aminothiazol-4-yl)acetic Acid-13C,15N2 Hydrochloride
TRC-A633334-50MG 50 mg

2-(2-Aminothiazol-4-yl)acetic Acid-13C,15N2 Hydrochloride

Sign In for Pricing
View Details
1-Amino-2-naphthol-4-sulfonic Acid
TRC-A619008-250MG 250 mg

1-Amino-2-naphthol-4-sulfonic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS642414 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
Human ZNF 556 (ZNF556) activation kit by CRISPRa
GA112802 1 Kit

Human ZNF 556 (ZNF556) activation kit by CRISPRa

Sign In for Pricing
View Details
LIM Kinase 1 (LIMK1) (NM_002314) Human Recombinant Protein
TP318058M 100 µg

LIM Kinase 1 (LIMK1) (NM_002314) Human Recombinant Protein

Sign In for Pricing
View Details