Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Os05g0317700 protein, partial

Product Specifications

Abbreviation

Recombinant Oryza sativa subsp. japonica Os05g0317700 protein, partial

UniProt

A0A0P0WKN4

Expression Region

26-439aa

Organism

Oryza sativa subsp. japonica (Rice)

Target Sequence

DNYSSSSSPIFLNCGASTMQLDINNRSWEGDTRSKFASAMNGIAASATYQDPSLPSLVPYMTSRIFISNYTYSFPISPGRIFVRLYFYPVAYGYYASEDAYFGVKTNNLILLDNFNASQTAQAANYAYILREFSLNVTLGSLDLTFFPSTQNGSYAFVNGIEIVPTPDIFTTRTPTHNTEGNLDPSDIDSMTSFQTMYRLNVGGQAIIPQGDSRFYRSWEDDSPYIYGAAFGVTFGKDSNVTITYPGTMPNYTAPADVYATARSMGPNWQINLNYNLTWILSVDAGFYYLLRFHFCEIQYPITKMNQRSFFIYINNQTVQDQMDVIRWSGGIGMATYADYLIVTVGSGQMDLWVALHPDLSSRPQYYDAILNGLEVFKLWDIGKKNLAGLNPPLPPQPKTDVNPKGVSGGGKLK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF594 conjugate, 0.1mg/mL
BNC940821-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details