Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MRG/MORF4L-binding protein (MRGBP)

Product Specifications

Product Name Alternative

MRG-binding protein; Up-regulated in colon cancer 4

Abbreviation

Recombinant Human MRGBP protein

Gene Name

MRGBP

UniProt

Q9NV56

Expression Region

2-204aa

Organism

Homo sapiens (Human)

Target Sequence

GEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus Influenzae xylA Protein (aa 1-439) (strain PittEE)
VAng-Lsx03965-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae xylA Protein (aa 1-439) (strain PittEE)

Sign In for Pricing
View Details
Recombinant Desulfovibrio salexigens GMP synthase [glutamine-hydrolyzing] (guaA), partial
MBS1122340 Inquire

Recombinant Desulfovibrio salexigens GMP synthase [glutamine-hydrolyzing] (guaA), partial

Sign In for Pricing
View Details
PDPK1 Antibody
DF6540-01 100 µL

PDPK1 Antibody

Sign In for Pricing
View Details
PDPK1 Antibody
DF6540-02 200 µL

PDPK1 Antibody

Sign In for Pricing
View Details
2,4,6-Tri-tert-butylpyridine
sc-225709A 5 g

2,4,6-Tri-tert-butylpyridine

Sign In for Pricing
View Details
CA125 Recombinant Rabbit mAb (SDT-555-41)
S0B2255-01 1 mL

CA125 Recombinant Rabbit mAb (SDT-555-41)

Sign In for Pricing
View Details