Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial

Product Specifications

Abbreviation

Recombinant Human MICB protein, partial

Gene Name

MICB

UniProt

ABO16470

Expression Region

204-297aa

Organism

Homo sapiens (Human)

Target Sequence

TVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)
MBS2037690-01 0.1 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)
MBS2037690-02 0.2 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)
MBS2037690-03 0.5 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)
MBS2037690-04 1 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)
MBS2037690-05 5 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)
MBS2037690-06 5x 5 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 10 (MMP10)

Sign In for Pricing
View Details