Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Diaphorina citri General odorant-binding protein 3 (LOC103507602)

Product Specifications

Abbreviation

Recombinant Diaphorina citri LOC103507602 protein

Gene Name

LOC103507602

UniProt

A0A1S3CYV9

Expression Region

24-140aa

Organism

Diaphorina citri (Asian citrus psyllid)

Target Sequence

EIDESMKAVAKMIHDQCVDDSGVDPAVMDRIFSTKTMEPDEKFKCYLMCGLQQISAMDDDGNVDSEVFIGTMPEEFKSYAMEVVKKCSDVGGTSPCDKAYNMNVCAQKVDPNKYVFI

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB561D1 Protein Vector (Rat) (pPM-C-His)
PV262609 500 ng

CYB561D1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TRAC ORF Vector (Human) (pORF)
47426011 1.0 µg DNA

TRAC ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
C2orf53 cDNA Clone
MBS1277155-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

C2orf53 cDNA Clone

Sign In for Pricing
View Details
C2orf53 cDNA Clone
MBS1277155-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

C2orf53 cDNA Clone

Sign In for Pricing
View Details
Ggt6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7343205 3x 1.0 µg

Ggt6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Nkx2.6 (NKX2-6) (NM_001136271) Human Tagged ORF Clone Lentiviral Particle
RC226770L4V 200 µL

Nkx2.6 (NKX2-6) (NM_001136271) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details