Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin (INS)

Product Specifications

Product Name Alternative

INS

Abbreviation

Recombinant Human INS protein

Gene Name

INS

UniProt

P01308

Expression Region

25-110aa

Organism

Homo sapiens (Human)

Target Sequence

FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atholate™, protein hydrolysate, 1 kg
0134-1 1 kg

Atholate™, protein hydrolysate, 1 kg

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-15373-01 50 μL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-15373-02 100 µL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-15373-03 1 mL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Human Transcobalamin I (TCN1) ELISA Kit
RD-TCN1-Hu-01 96 Tests

Human Transcobalamin I (TCN1) ELISA Kit

Sign In for Pricing
View Details
Human Transcobalamin I (TCN1) ELISA Kit
RD-TCN1-Hu-02 48 Tests

Human Transcobalamin I (TCN1) ELISA Kit

Sign In for Pricing
View Details