Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Somatotropin (GH1)

Product Specifications

Product Name Alternative

Growth hormone; Growth hormone 1; Pituitary growth hormone

Abbreviation

Recombinant Rhesus macaque GH1 protein

Gene Name

GH1

UniProt

P33093

Expression Region

27-217aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNNDALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salicylic Acid Acyl Glucoside
TRC-S088115-5MG 5 mg

Salicylic Acid Acyl Glucoside

Sign In for Pricing
View Details
HLA-Pan (MHC II) (rHLA-Pan/3475), CF647 conjugate, 0.1mg/mL
BNC473475-500 1x 500 µL

HLA-Pan (MHC II) (rHLA-Pan/3475), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCAF5 Rabbit Polyclonal Antibody
TA372398 100 µL

DCAF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prealbumin Recombinant Rabbit Monoclonal Antibody [JF1016]
ET1702-42 100 µL

Prealbumin Recombinant Rabbit Monoclonal Antibody [JF1016]

Sign In for Pricing
View Details
CEE (GET4) Human Gene Knockout Kit (CRISPR)
KN400220 1 Kit

CEE (GET4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Low density lipoprotein receptor related protein 10 (LRP10) Human Gene Knockout Kit (CRISPR)
KN421719 1 Kit

Low density lipoprotein receptor related protein 10 (LRP10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details