Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome P450 11B1, mitochondrial (CYP11B1)

Product Specifications

Product Name Alternative

CYPXIB1; Cytochrome P-450c11; Steroid 11-beta-hydroxylase, CYP11B1

Abbreviation

Recombinant Human CYP11B1 protein

Gene Name

CYP11B1

UniProt

P15538

Expression Region

25-503aa

Organism

Homo sapiens (Human)

Target Sequence

GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

A cytochrome P450 monooxygenase involved in the biosynthesis of adrenal corticoids. Catalyzes a variety of reactions that are essential for many species, including detoxification, defense, and the formation of endogenous chemicals like steroid hormones. Steroid 11beta, 18- and 19-hydroxylase with preferred regioselectivity at 11beta, then 18, and lastly 19. Catalyzes the hydroxylation of 11-deoxycortisol and 11-deoxycorticosterone (21-hydroxyprogesterone) at 11beta position, yielding cortisol or corticosterone, respectively, but cannot produce aldosterone. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate for hydroxylation and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin) . Due to its lack of 18-oxidation activity, it is incapable of generating aldosterone. Could also be involved in the androgen metabolic pathway (Probable)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

64.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal TRAILR3/TNFRSF10C Antibody (003) [Alexa Fluor 647]
NBP2-89484AF647 0.1 mL

Rabbit Monoclonal TRAILR3/TNFRSF10C Antibody (003) [Alexa Fluor 647]

Ask
View Details
Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)
MBS1221532-01 0.02 mg (E-Coli)

Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)

Ask
View Details
Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)
MBS1221532-02 0.1 mg (E-Coli)

Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)

Ask
View Details
Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)
MBS1221532-03 0.02 mg (Yeast)

Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)

Ask
View Details
Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)
MBS1221532-04 0.1 mg (Yeast)

Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)

Ask
View Details
Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)
MBS1221532-05 0.02 mg (Baculovirus)

Recombinant Drosophila simulans Protein N-terminal glutamine amidohydrolase (tun)

Ask
View Details