Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 5 (CD300LD), partial, Biotinylated

Product Specifications

Product Name Alternative

CD300 antigen-like family member D; CMRF35-A4

Abbreviation

Recombinant Human CD300LD protein, partial, Biotinylated

Gene Name

CD300LD

UniProt

Q6UXZ3

Expression Region

19-165aa

Organism

Homo sapiens (Human)

Target Sequence

AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH

Tag

N-terminal 6xHis-SUMO3-Avi-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHV4-30-4 sgRNA CRISPR Lentivector (Human) (Target 1)
K1043102 1.0 µg DNA

IGHV4-30-4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SSX6 (Putative Protein SSX6, Synovial Sarcoma, X Breakpoint 6 (Pseudogene) )
492925 100 µL

SSX6 (Putative Protein SSX6, Synovial Sarcoma, X Breakpoint 6 (Pseudogene) )

Sign In for Pricing
View Details
Recombinant DENV-2 Envelope protein E Protein, N-His-GFP
orb2966261-01 50 µg

Recombinant DENV-2 Envelope protein E Protein, N-His-GFP

Sign In for Pricing
View Details
Recombinant DENV-2 Envelope protein E Protein, N-His-GFP
orb2966261-02 100 µg

Recombinant DENV-2 Envelope protein E Protein, N-His-GFP

Sign In for Pricing
View Details
Recombinant DENV-2 Envelope protein E Protein, N-His-GFP
orb2966261-03 1 mg

Recombinant DENV-2 Envelope protein E Protein, N-His-GFP

Sign In for Pricing
View Details
C1S Recombinant Monoclonal Antibody
MBS9020922-01 0.05 mL

C1S Recombinant Monoclonal Antibody

Sign In for Pricing
View Details