Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q subcomponent subunit C (C1QC), partial

Product Specifications

Product Name Alternative

C1QC

Abbreviation

Recombinant Human C1QC protein, partial

Gene Name

C1QC

UniProt

P02747

Expression Region

27-157aa

Organism

Homo sapiens (Human)

Target Sequence

QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGK

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) OST2 Polyclonal Antibody
MBS7180981 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) OST2 Polyclonal Antibody

Sign In for Pricing
View Details
CILP1 Polyclonal Antibody
RA31627-01 50 µL

CILP1 Polyclonal Antibody

Sign In for Pricing
View Details
CILP1 Polyclonal Antibody
RA31627-02 100 µL

CILP1 Polyclonal Antibody

Sign In for Pricing
View Details
Ngp AAV siRNA Pooled Vector
31803166 1.0 µg

Ngp AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Chicken LRP2 Binding Protein (LRP2BP) ELISA Kit
MBS9920214 Inquire

Chicken LRP2 Binding Protein (LRP2BP) ELISA Kit

Sign In for Pricing
View Details
Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Rabbit mAb, Cy5 conjugated
orb1587274 100 µL

Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Rabbit mAb, Cy5 conjugated

Sign In for Pricing
View Details