Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf)

Product Specifications

Product Name Alternative

B-cell-activating transcription factor

Abbreviation

Recombinant Mouse Batf protein

Gene Name

Batf

UniProt

O35284

Expression Region

1-125aa

Organism

Mus musculus (Mouse)

Target Sequence

MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8 (+) dendritic cells and class-switch recombination (CSR) in B-cells. Acts via the formation of a heterodimer with JUNB that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3'. The BATF-JUNB heterodimer also forms a complex with IRF4 (or IRF8) in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 (or IRF8) and activation of genes. Controls differentiation of T-helper cells producing interleukin-17 (Th17 cells) by binding to Th17-associated gene promoters: regulates expression of the transcription factor RORC itself and RORC target genes such as IL17 (IL17A or IL17B) . Also involved in differentiation of follicular T-helper cells (TfH) by directing expression of BCL6 and MAF. In B-cells, involved in class-switch recombination (CSR) by controlling the expression of both AICDA and of germline transcripts of the intervening heavy-chain region and constant heavy-chain region (I (H) -C (H) ) . Following infection, can participate in CD8 (+) dendritic cell differentiation via interaction with IRF4 and IRF8 to mediate cooperative gene activation. Regulates effector CD8 (+) T-cell differentiation by regulating expression of SIRT1. Following DNA damage, part of a differentiation checkpoint that limits self-renewal of hematopoietic stem cells (HSCs) : up-regulated by STAT3, leading to differentiation of HSCs, thereby restricting self-renewal of HSCs

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD42b/GPIb alpha Antibody (HIP1) [HRP]
NB500-511H 0.1 mL

Mouse Monoclonal CD42b/GPIb alpha Antibody (HIP1) [HRP]

Ask
View Details
Bilharzia, Male And Female
4081250 1 Each

Bilharzia, Male And Female

Ask
View Details
C19orf44 (NM_001288834) Human Tagged ORF Clone
RG239136 10 µg

C19orf44 (NM_001288834) Human Tagged ORF Clone

Ask
View Details
C21orf86 Human shRNA Plasmid Kit (Locus ID 257103)
TR319959 1 Kit

C21orf86 Human shRNA Plasmid Kit (Locus ID 257103)

Ask
View Details
Anti-Smad9 Antibody Picoband
MBS1758545-01 0.01 mg

Anti-Smad9 Antibody Picoband

Ask
View Details
Anti-Smad9 Antibody Picoband
MBS1758545-02 0.1 mg (Carrier Free)

Anti-Smad9 Antibody Picoband

Ask
View Details