Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin-A1 (EFNA1) (Active)

Product Specifications

Product Name Alternative

Ephrin-A1; EPH-related receptor tyrosine kinase ligand 1 (LERK-1) ; Immediate early response protein B61; Tumor necrosis factor alpha-induced protein 4 (TNF alpha-induced protein 4) ; Ephrin-A1, secreted form; EFNA1; EPLG1, LERK1, TNFAIP4

Abbreviation

Recombinant Human EFNA1 protein (Active)

Gene Name

EFNA1

UniProt

P20827

Expression Region

19-182aa

Organism

Homo sapiens (Human)

Target Sequence

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human EPHA2 (CSB-MP007722HUd7) at 2 μg/mL can bind Human EFNA1. The EC50 is 5.859-7.758 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.3 kDa

References & Citations

Biological and structural characterization of glycosylation on ephrin-A1, a preferred ligand for EphA2 receptor tyrosine kinase. Ferluga S., Hantgan R., Goldgur Y., Himanen J.P., Nikolov D.B., Debinski W. J. Biol. Chem. 288:18448-18457 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snrk Mouse Gene Knockout Kit (CRISPR)
KN516392 1 Kit

Snrk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BRP44L (MPC1) Human Gene Knockout Kit (CRISPR)
KN401461 1 Kit

BRP44L (MPC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nickel Sulfate Hexahydrate
TRC-N901063-5G 5 g

Nickel Sulfate Hexahydrate

Sign In for Pricing
View Details
Human ZFYVE28 activation kit by CRISPRa
GA111720 1 Kit

Human ZFYVE28 activation kit by CRISPRa

Sign In for Pricing
View Details
Plekhb2 (BC057994) Mouse Tagged ORF Clone
MG202046 10 µg

Plekhb2 (BC057994) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CTPS2 (NM_175859) Human Recombinant Protein
TP320566L 1 mg

CTPS2 (NM_175859) Human Recombinant Protein

Sign In for Pricing
View Details