Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 2A (SPRR2A)

Product Specifications

Product Name Alternative

SPR-2A;2-1

Abbreviation

Recombinant Human SPRR2A protein

Gene Name

SPRR2A

UniProt

P35326

Expression Region

1-72aa

Organism

Homo sapiens (Human)

Target Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Gut bactericidal protein that selectively kills Gram-positive bacteria by binding to negatively charged lipids on bacterial membranes, leading to bacterial membrane permeabilization and disruption. Specifically binds lipids bearing negatively charged headgroups, such as phosphatidic acid, phosphatidylserine (PS), cardiolipin (CL), and phosphatidylinositol phosphates, but not to zwitterionic or neutral lipids. Induced by type-2 cytokines in response to helminth infection and is required to protect against helminth-induced bacterial invasion of intestinal tissue. May also be involved in the development of the cornified envelope of squamous epithelia; however, additional evidences are required to confirm this result in vivo.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btf3l4 Mouse Gene Knockout Kit (CRISPR)
KN502305 1 Kit

Btf3l4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743H-01 25 µg

PE/Cyanine7 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743H-02 100 µg

PE/Cyanine7 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
PARP8 Human Gene Knockout Kit (CRISPR)
KN420324 1 Kit

PARP8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF594 conjugate, 0.1mg/mL
BNC941274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-3-(Tributylstannyl)-2-propen-1-amine
TRC-T773975-500MG 500 mg

E-3-(Tributylstannyl)-2-propen-1-amine

Sign In for Pricing
View Details