Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet factor 4 (PF4)

Product Specifications

Product Name Alternative

PF-4; C-X-C motif chemokine 4; Iroplact; Oncostatin-A; Endothelial cell growth inhibitor

Abbreviation

Recombinant Human PF4 protein

Gene Name

PF4

UniProt

P02776

Expression Region

32-101aa

Organism

Homo sapiens (Human)

Target Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Tag

N-terminal 6xHis-tagge

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a44 AAV siRNA Pooled Vector
44034164 1.0 µg

Slc25a44 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DMRT2 siRNA (Mouse)
MBS8211108-01 15 nmol

DMRT2 siRNA (Mouse)

Sign In for Pricing
View Details
DMRT2 siRNA (Mouse)
MBS8211108-02 30 nmol

DMRT2 siRNA (Mouse)

Sign In for Pricing
View Details
DMRT2 siRNA (Mouse)
MBS8211108-03 5x 30 nmol

DMRT2 siRNA (Mouse)

Sign In for Pricing
View Details
Equine infectious anemia virus One-Step PCR kit
Oneq-V162-150R 150 Reactions

Equine infectious anemia virus One-Step PCR kit

Sign In for Pricing
View Details
Amotl2 Mouse shRNA Lentiviral Particle (Locus ID 56332)
TL519182V 500 µL Each

Amotl2 Mouse shRNA Lentiviral Particle (Locus ID 56332)

Sign In for Pricing
View Details