Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Major allergen I polypeptide chain 2 (CH2)

Product Specifications

Product Name Alternative

AG4; Allergen Cat-1; Allergen Fel d I-B (Allergen FdI) ; Fel d 1-B; CH2

Abbreviation

Recombinant Cat CH2 protein

Gene Name

CH2

UniProt

P30440

Expression Region

18-109aa

Organism

Felis catus (Cat) (Felis silvestris catus)

Target Sequence

VKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Per1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7465107 1.0 µg DNA

Per1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1372038-01 0.02 mg (E-Coli)

Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1372038-02 0.02 mg (Yeast)

Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1372038-03 0.1 mg (E-Coli)

Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1372038-04 0.1 mg (Yeast)

Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1372038-05 0.02 mg (Baculovirus)

Recombinant Bordetella pertussis Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details