Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Complement C3 (C3), partial

Product Specifications

Product Name Alternative

C3bc; ASP; C3adesArg

Abbreviation

Recombinant Pig C3 protein, partial

Gene Name

C3

UniProt

P01025

Expression Region

1001-1302aa

Organism

Sus scrofa (Pig)

Target Sequence

LIQTPSGCGEQNMIGMTPTVIAVHYLDSTEQWEKFGLEKRQEALELIKKGYTQQLAFRQKNSAFAAFQDRLSSTLLTAYVVKVFAMAANLIAIDSQVLCGAVKWLILEKQKPDGVFEENGPVIHQEMIGGFKNTEEKDVSLTAFVLIALQEAKDICEPQVNSLLRSINKARDFLADYYLELKRPYTVAIAGYALALSDKLDEPFLNKLLSTAKERNRWEEPGQKLHNVEATSYALLALLVVKDFDSVPPIVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDVPDHKDLNLDVSIHLPSRS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. ; Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. In chronic inflammation, acts as a chemoattractant for neutrophils. ; [C3-beta-c]: Acts as a chemoattractant for neutrophils in chronic inflammation. ; [Acylation stimulating protein]: Adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in post-prandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-internalization and recycling of C5AR2.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CCNH sgRNA gene knockout kit - Lentiviral human CCNH sgRNA gene knockout kit (25)
GTR15355580 1 Vial

Lentiviral human CCNH sgRNA gene knockout kit - Lentiviral human CCNH sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Melanophilin Blocking Peptide
MBS9620868-01 1 mg

Melanophilin Blocking Peptide

Sign In for Pricing
View Details
Melanophilin Blocking Peptide
MBS9620868-02 5x 1 mg

Melanophilin Blocking Peptide

Sign In for Pricing
View Details
LHFPL1, NT (LHFPL1, Lipoma HMGIC fusion partner-like 1 protein)
037764 200 µL

LHFPL1, NT (LHFPL1, Lipoma HMGIC fusion partner-like 1 protein)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038069-01 1 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)
MBS2038069-02 5 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 30 Ligand (CD30L)

Sign In for Pricing
View Details