Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Artemisia vulgaris Art v 2 allergen (art v 2)

Product Specifications

Product Name Alternative

Art v 2

Abbreviation

Recombinant Artemisia vulgaris art v 2 protein

Gene Name

Art v 2

UniProt

A6GVD5

Expression Region

24-162aa

Organism

Artemisia vulgaris (Mugwort)

Target Sequence

HETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDEIGKVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin Rabbit mAb
MBS9466898-01 0.05 mL

Calretinin Rabbit mAb

Sign In for Pricing
View Details
Calretinin Rabbit mAb
MBS9466898-02 0.1 mL

Calretinin Rabbit mAb

Sign In for Pricing
View Details
Calretinin Rabbit mAb
MBS9466898-03 5x 0.1 mL

Calretinin Rabbit mAb

Sign In for Pricing
View Details
SLC25A11 (NM_001165417) Human Tagged Lenti ORF Clone
RC228236L4 10 µg

SLC25A11 (NM_001165417) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Sod3 Pre-designed siRNA Set A
SI113575A 1 Each

Mouse Sod3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Bpifb4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV700040 1.0 µg DNA

Bpifb4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details